Names & Taxonomy
- Uniprot ID:
- O15245
- Entry Name:
- S22A1_HUMAN
- Status:
- reviewed
- Protein Names:
- Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
- Gene Names:
- SLC22A1 OCT1
- Gene Names Primary:
- SLC22A1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 554
- Sequence:
- MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Basolateral cell membrane
Function
- Function:
- Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.
- Kinetics:
- BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.47 mM for metformin
- Cross Reference Drug Bank:
- DB01193 DB01614 DB03128 DB00787 DB00915 DB00594 DB00345 DB00520 DB01114 DB00477 DB00122 DB00501 DB00242 DB00575 DB00318 DB00987 DB01151 DB00917 DB01075 DB00280 DB00988 DB00668 DB00783 DB04574 DB01004 DB00406 DB00536 DB00667 DB00619 DB00458 DB00224 DB00709 DB00654 DB00331 DB00683 DB00220 DB00184 DB00368 DB00526 DB01337 DB00914 DB00925 DB01621 DB00413 DB00457 DB01032 DB01035 DB00396 DB00908 DB00468 DB00863 DB00206 DB00728 DB01232 DB00127 DB00624 DB00152 DB01622 DB01623 DB01199 DB01339 DB00661
- Gene Ontology Go:
- basolateral plasma membrane
integral component of plasma membrane
membrane
plasma membrane
acetylcholine transmembrane transporter activity
dopamine transmembrane transporter activity
norepinephrine transmembrane transporter activity
organic cation transmembrane transporter activity
quaternary ammonium group transmembrane transporter activity
secondary active organic cation transmembrane transporter activity
dopamine transport
drug transmembrane transport
epinephrine transport
establishment or maintenance of transmembrane electrochemical gradient
neurotransmitter transport
norepinephrine transport
organic cation transport
protein homooligomerization
small molecule metabolic process
transmembrane transport - Gene Ontology Biological Process:
- dopamine transport
drug transmembrane transport
epinephrine transport
establishment or maintenance of transmembrane electrochemical gradient
neurotransmitter transport
norepinephrine transport
organic cation transport
protein homooligomerization
small molecule metabolic process
transmembrane transport - Gene Ontology Molecular Function:
- acetylcholine transmembrane transporter activity
dopamine transmembrane transporter activity
norepinephrine transmembrane transporter activity
organic cation transmembrane transporter activity
quaternary ammonium group transmembrane transporter activity
secondary active organic cation transmembrane transporter activity - Gene Ontology Cellular Component:
- basolateral plasma membrane
integral component of plasma membrane
membrane
plasma membrane - Keywords:
- Alternative splicing
Cell membrane
Complete proteome
Glycoprotein
Ion transport
Membrane
Phosphoprotein
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix
Transport - Interacts With:
- Q96G23