Drug Miner Browse

Uniprot ID:: O14949
Entry Name:: QCR8_HUMAN
Status:: reviewed
Protein Names:: Cytochrome b-c1 complex subunit 8 (Complex III subunit 8) (Complex III subunit VIII) (Ubiquinol-cytochrome c reductase complex 9.5 kDa protein) (Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C)
Gene Names:: UQCRQ
Gene Names Primary:: UQCRQ
Organism:: Homo sapiens (Human)

Length:: 82
Sequence:: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
Proteomes:: UP000005640

Function:: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Gene Ontology Go:: mitochondrial inner membrane
mitochondrion
respiratory chain
ubiquinol-cytochrome-c reductase activity
cellular metabolic process
cerebellar Purkinje cell layer development
hippocampus development
hypothalamus development
midbrain development
pons development
pyramidal neuron development
respiratory electron transport chain
small molecule metabolic process
subthalamus development
thalamus development
Gene Ontology Biological Process:: cellular metabolic process
cerebellar Purkinje cell layer development
hippocampus development
hypothalamus development
midbrain development
pons development
pyramidal neuron development
respiratory electron transport chain
small molecule metabolic process
subthalamus development
thalamus development
Gene Ontology Molecular Function:: ubiquinol-cytochrome-c reductase activity
Gene Ontology Cellular Component:: mitochondrial inner membrane
mitochondrion
respiratory chain
Keywords:: Acetylation
Complete proteome
Direct protein sequencing
Disease mutation
Electron transport
Isopeptide bond
Membrane
Mitochondrion
Mitochondrion inner membrane
Reference proteome
Respiratory chain
Transport
Ubl conjugation