Names & Taxonomy
- Uniprot ID:
- B7Z225
- Entry Name:
- B7Z225_HUMAN
- Status:
- unreviewed
- Protein Names:
- Long-chain fatty acid transport protein 1 (cDNA FLJ50069, highly similar to Long-chain fatty acid transport protein 1 (EC 6.2.1.-)) (cDNA, FLJ78834, highly similar to Long-chain fatty acid transport protein 1 (EC 6.2.1.-))
- Gene Names:
- SLC27A1
- Gene Names Primary:
- SLC27A1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 224
- Sequence:
- MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAGEARRGHQVGGDPGLAPGRAGRCCAPGLGRRPPWTWA
- Proteomes:
- UP000005640
Function
- Gene Ontology Go:
- integral component of membrane
fatty acid transporter activity
long-chain fatty acid-CoA ligase activity
very long-chain fatty acid-CoA ligase activity - Gene Ontology Molecular Function:
- fatty acid transporter activity
long-chain fatty acid-CoA ligase activity
very long-chain fatty acid-CoA ligase activity - Gene Ontology Cellular Component:
- integral component of membrane
- Keywords:
- Complete proteome
Proteomics identification
Reference proteome
Publication
- PubMed ID:
- 15057824