Names & Taxonomy
- Uniprot ID:
- Q9Y655
- Entry Name:
- Q9Y655_HUMAN
- Status:
- unreviewed
- Protein Names:
- Myelin gene expression factor 2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 547
- Sequence:
- MENDESAKEEKSDLKEKSTGSKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKSRGCGVVEFKDEEFVKKALETMNKYDLSGRRVNIKEDPDGENARRALQRTGTSFQGSHASDVGSGLVNLPPSILNNPNIPPEVISNLQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKAGSYKEDKDGKSRGMGTVTFEQAIEAVQAISMFNGQFLFDRPMHVKMDDKSVPHEEYRSPDGKTPQLPRGLGGIGMGLGPGGQPISASQLNIGGVMGNLGPGGMGMDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGHRDIGLSRGFGDSFGRLGSAMIGGITGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA
Function
- Gene Ontology Go:
- nucleus
nucleic acid binding
nucleotide binding
transcription coactivator activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
myoblast fate determination
regulation of nucleic acid-templated transcription
regulation of transcription from RNA polymerase II promoter
transcription from RNA polymerase II promoter - Gene Ontology Biological Process:
- myoblast fate determination
regulation of nucleic acid-templated transcription
regulation of transcription from RNA polymerase II promoter
transcription from RNA polymerase II promoter - Gene Ontology Molecular Function:
- nucleic acid binding
nucleotide binding
transcription coactivator activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding - Gene Ontology Cellular Component:
- nucleus