Names & Taxonomy
- Uniprot ID:
- Q9H490
- Entry Name:
- PIGU_HUMAN
- Status:
- reviewed
- Protein Names:
- Phosphatidylinositol glycan anchor biosynthesis class U protein (Cell division cycle protein 91-like 1) (Protein CDC91-like 1) (GPI transamidase component PIG-U)
- Gene Names:
- PIGU CDC91L1 PSEC0205 UNQ3055/PRO9875
- Gene Names Orf:
- PSEC0205 UNQ3055/PRO9875
- Gene Names Primary:
- PIGU
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 435
- Sequence:
- MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum membrane
Function
- Function:
- Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.
- Pathway:
- Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
- Gene Ontology Go:
- endoplasmic reticulum membrane
GPI-anchor transamidase complex
integral component of endoplasmic reticulum membrane
membrane
plasma membrane
attachment of GPI anchor to protein
C-terminal protein lipidation
cellular protein metabolic process
GPI anchor biosynthetic process
post-translational protein modification
regulation of JAK-STAT cascade - Gene Ontology Biological Process:
- attachment of GPI anchor to protein
cellular protein metabolic process
C-terminal protein lipidation
GPI anchor biosynthetic process
post-translational protein modification
regulation of JAK-STAT cascade - Gene Ontology Cellular Component:
- endoplasmic reticulum membrane
GPI-anchor transamidase complex
integral component of endoplasmic reticulum membrane
membrane
plasma membrane - Keywords:
- Alternative splicing
Complete proteome
Direct protein sequencing
Endoplasmic reticulum
GPI-anchor biosynthesis
Membrane
Reference proteome
Transmembrane
Transmembrane helix