Names & Taxonomy
- Uniprot ID:
- Q99523
- Entry Name:
- SORT_HUMAN
- Status:
- reviewed
- Protein Names:
- Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)
- Gene Names:
- SORT1
- Gene Names Primary:
- SORT1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 831
- Sequence:
- MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane
Function
- Function:
- Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.
- Gene Ontology Go:
- cell surface
clathrin-coated vesicle
coated pit
cytoplasmic, membrane-bounded vesicle
dendrite
early endosome
endoplasmic reticulum membrane
endosome membrane
Golgi apparatus
Golgi cisterna membrane
integral component of membrane
lysosomal membrane
neuronal cell body
nuclear membrane
perinuclear region of cytoplasm
plasma membrane
trans-Golgi network transport vesicle
enzyme binding
nerve growth factor binding
nerve growth factor receptor activity
neurotensin receptor activity, non-G-protein coupled
endocytosis
endosome to lysosome transport
endosome transport via multivesicular body sorting pathway
extrinsic apoptotic signaling pathway via death domain receptors
G-protein coupled receptor signaling pathway
glucose import
Golgi to endosome transport
multicellular organism development
myotube differentiation
negative regulation of fat cell differentiation
negative regulation of lipoprotein lipase activity
nerve growth factor signaling pathway
neuropeptide signaling pathway
neurotrophin TRK receptor signaling pathway
ossification
plasma membrane to endosome transport
positive regulation of epithelial cell apoptotic process
regulation of gene expression
response to insulin
vesicle organization - Gene Ontology Biological Process:
- endocytosis
endosome to lysosome transport
endosome transport via multivesicular body sorting pathway
extrinsic apoptotic signaling pathway via death domain receptors
glucose import
Golgi to endosome transport
G-protein coupled receptor signaling pathway
multicellular organism development
myotube differentiation
negative regulation of fat cell differentiation
negative regulation of lipoprotein lipase activity
nerve growth factor signaling pathway
neuropeptide signaling pathway
neurotrophin TRK receptor signaling pathway
ossification
plasma membrane to endosome transport
positive regulation of epithelial cell apoptotic process
regulation of gene expression
response to insulin
vesicle organization - Gene Ontology Molecular Function:
- enzyme binding
nerve growth factor binding
nerve growth factor receptor activity
neurotensin receptor activity, non-G-protein coupled - Gene Ontology Cellular Component:
- cell surface
clathrin-coated vesicle
coated pit
cytoplasmic, membrane-bounded vesicle
dendrite
early endosome
endoplasmic reticulum membrane
endosome membrane
Golgi apparatus
Golgi cisterna membrane
integral component of membrane
lysosomal membrane
neuronal cell body
nuclear membrane
perinuclear region of cytoplasm
plasma membrane
trans-Golgi network transport vesicle - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Cleavage on pair of basic residues
Complete proteome
Developmental protein
Differentiation
Direct protein sequencing
Disulfide bond
Endocytosis
Endoplasmic reticulum
Endosome
Glycoprotein
Golgi apparatus
Lysosome
Membrane
Nucleus
Osteogenesis
Phosphoprotein
Polymorphism
Receptor
Reference proteome
Repeat
Signal
Transmembrane
Transmembrane helix
Transport - Interacts With:
- Q9UJY5; P11151; P01138; P04629; Q16288