Names & Taxonomy
- Uniprot ID:
- Q96SL4
- Entry Name:
- GPX7_HUMAN
- Status:
- reviewed
- Protein Names:
- Glutathione peroxidase 7 (GPx-7) (GSHPx-7) (EC 1.11.1.9) (CL683)
- Gene Names:
- GPX7 GPX6 UNQ469/PRO828
- Gene Names Orf:
- UNQ469/PRO828
- Gene Names Primary:
- GPX7
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 187
- Sequence:
- MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.
- Catalytic Activity:
- 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
- Active Site:
- ACT_SITE 57 57
- Cross Reference Drug Bank:
- DB00143
- Gene Ontology Go:
- endoplasmic reticulum
endoplasmic reticulum lumen
extracellular region
catalase activity
glutathione peroxidase activity
peroxidase activity
cellular oxidant detoxification
response to reactive oxygen species - Gene Ontology Biological Process:
- cellular oxidant detoxification
response to reactive oxygen species - Gene Ontology Molecular Function:
- catalase activity
glutathione peroxidase activity
peroxidase activity - Gene Ontology Cellular Component:
- endoplasmic reticulum
endoplasmic reticulum lumen
extracellular region - Keywords:
- 3D-structure
Complete proteome
Oxidoreductase
Peroxidase
Reference proteome
Secreted
Signal - Interacts With:
- O43681; Q8NHQ1