Names & Taxonomy
- Uniprot ID:
- Q969S0
- Entry Name:
- S35B4_HUMAN
- Status:
- reviewed
- Protein Names:
- UDP-xylose and UDP-N-acetylglucosamine transporter (Solute carrier family 35 member B4) (YEA4 homolog)
- Gene Names:
- SLC35B4 YEA4 PSEC0055
- Gene Names Orf:
- PSEC0055
- Gene Names Primary:
- SLC35B4
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 331
- Sequence:
- MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPVIGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Golgi apparatus membrane
Function
- Function:
- Sugar transporter that specifically mediates the transport of UDP-xylose (UDP-Xyl) and UDP-N-acetylglucosamine (UDP-GlcNAc) from cytosol into Golgi.
- Gene Ontology Go:
- endoplasmic reticulum
Golgi apparatus
Golgi membrane
integral component of membrane
UDP-N-acetylglucosamine transmembrane transporter activity
UDP-xylose transmembrane transporter activity
carbohydrate transport
regulation of gluconeogenesis
transmembrane transport
UDP-N-acetylglucosamine transmembrane transport
UDP-N-acetylglucosamine transport
UDP-xylose transport - Gene Ontology Biological Process:
- carbohydrate transport
regulation of gluconeogenesis
transmembrane transport
UDP-N-acetylglucosamine transmembrane transport
UDP-N-acetylglucosamine transport
UDP-xylose transport - Gene Ontology Molecular Function:
- UDP-N-acetylglucosamine transmembrane transporter activity
UDP-xylose transmembrane transporter activity - Gene Ontology Cellular Component:
- endoplasmic reticulum
Golgi apparatus
Golgi membrane
integral component of membrane - Keywords:
- Alternative splicing
Complete proteome
Golgi apparatus
Membrane
Reference proteome
Sugar transport
Transmembrane
Transmembrane helix
Transport - Interacts With:
- Q96BA8