Names & Taxonomy
- Uniprot ID:
- Q8WYK2
- Entry Name:
- JDP2_HUMAN
- Status:
- reviewed
- Protein Names:
- Jun dimerization protein 2
- Gene Names:
- JDP2
- Gene Names Primary:
- JDP2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 163
- Sequence:
- MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus
Function
- Function:
- Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin.
- Cross Reference Drug Bank:
- DB00852
- Gene Ontology Go:
- nucleus
chromatin binding
RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
negative regulation of fat cell differentiation
positive regulation of histone deacetylation
transcription, DNA-templated - Gene Ontology Biological Process:
- negative regulation of fat cell differentiation
positive regulation of histone deacetylation
transcription, DNA-templated - Gene Ontology Molecular Function:
- chromatin binding
RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding - Gene Ontology Cellular Component:
- nucleus
- Keywords:
- Alternative splicing
Complete proteome
DNA-binding
Isopeptide bond
Nucleus
Phosphoprotein
Polymorphism
Reference proteome
Repressor
Transcription
Transcription regulation
Ubl conjugation - Interacts With:
- Q8IU81