Names & Taxonomy
- Uniprot ID:
- Q8TF71
- Entry Name:
- MOT10_HUMAN
- Status:
- reviewed
- Protein Names:
- Monocarboxylate transporter 10 (MCT 10) (Aromatic amino acid transporter 1) (Solute carrier family 16 member 10) (T-type amino acid transporter 1)
- Gene Names:
- SLC16A10 MCT10 TAT1
- Gene Names Primary:
- SLC16A10
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 515
- Sequence:
- MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVYLQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAIGFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Sodium-independent transporter that mediates the update of aromatic acid. Can function as a net efflux pathway for aromatic amino acids in the basosolateral epithelial cells (By similarity).
- Cross Reference Drug Bank:
- DB06262 DB00145 DB00160 DB00125 DB00174 DB00128 DB00151 DB00138 DB00130 DB00117 DB00167 DB00149 DB00123 DB00134 DB00120 DB00172 DB00133 DB00156 DB00150 DB00135 DB00161 DB04398 DB01235 DB00279 DB01583 DB00119
- Gene Ontology Go:
- basolateral plasma membrane
integral component of membrane
integral component of plasma membrane
plasma membrane
aromatic amino acid transmembrane transporter activity
thyroid hormone transmembrane transporter activity
transporter activity
amino acid transport
aromatic amino acid transport
ion transmembrane transport
ion transport
transmembrane transport - Gene Ontology Biological Process:
- amino acid transport
aromatic amino acid transport
ion transmembrane transport
ion transport
transmembrane transport - Gene Ontology Molecular Function:
- aromatic amino acid transmembrane transporter activity
thyroid hormone transmembrane transporter activity
transporter activity - Gene Ontology Cellular Component:
- basolateral plasma membrane
integral component of membrane
integral component of plasma membrane
plasma membrane - Keywords:
- Cell membrane
Complete proteome
Membrane
Phosphoprotein
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix
Transport