Names & Taxonomy
- Uniprot ID:
- Q8TCT9
- Entry Name:
- HM13_HUMAN
- Status:
- reviewed
- Protein Names:
- Minor histocompatibility antigen H13 (EC 3.4.23.-) (Intramembrane protease 1) (IMP-1) (IMPAS-1) (hIMP1) (Presenilin-like protein 3) (Signal peptide peptidase)
- Gene Names:
- HM13 H13 IMP1 PSL3 SPP MSTP086
- Gene Names Orf:
- MSTP086
- Gene Names Primary:
- HM13
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 377
- Sequence:
- MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Endoplasmic reticulum membrane
Function
- Function:
- Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides (PubMed:11714810). May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein (PubMed:12145199). Involved in the intramembrane cleavage of the integral membrane protein PSEN1 (PubMed:12077416, PubMed:11714810, PubMed:14741365). Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139-dependent manner (PubMed:25239945). May play a role in graft rejection (By similarity).
- Active Site:
- ACT_SITE 219 219
- Gene Ontology Go:
- cell surface
Derlin-1 retrotranslocation complex
endoplasmic reticulum
endoplasmic reticulum membrane
integral component of cytoplasmic side of endoplasmic reticulum membrane
integral component of lumenal side of endoplasmic reticulum membrane
membrane
plasma membrane
rough endoplasmic reticulum
aspartic endopeptidase activity, intramembrane cleaving
peptidase activity
protein homodimerization activity
ubiquitin protein ligase binding
membrane protein proteolysis
membrane protein proteolysis involved in retrograde protein transport, ER to cytosol
protein homotetramerization - Gene Ontology Biological Process:
- membrane protein proteolysis
membrane protein proteolysis involved in retrograde protein transport, ER to cytosol
protein homotetramerization - Gene Ontology Molecular Function:
- aspartic endopeptidase activity, intramembrane cleaving
peptidase activity
protein homodimerization activity
ubiquitin protein ligase binding - Gene Ontology Cellular Component:
- cell surface
Derlin-1 retrotranslocation complex
endoplasmic reticulum
endoplasmic reticulum membrane
integral component of cytoplasmic side of endoplasmic reticulum membrane
integral component of lumenal side of endoplasmic reticulum membrane
membrane
plasma membrane
rough endoplasmic reticulum - Keywords:
- Alternative splicing
Cell membrane
Complete proteome
Direct protein sequencing
Endoplasmic reticulum
Glycoprotein
Hydrolase
Membrane
Phosphoprotein
Polymorphism
Protease
Reference proteome
Transmembrane
Transmembrane helix - Interacts With:
- Q9BUN8; Q9BRK4; P07237; Q8WU17; P17861-1