Names & Taxonomy
- Uniprot ID:
- P15291
- Entry Name:
- B4GT1_HUMAN
- Status:
- reviewed
- Protein Names:
- Beta-1,4-galactosyltransferase 1 (Beta-1,4-GalTase 1) (Beta4Gal-T1) (b4Gal-T1) (EC 2.4.1.-) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1) (UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1) [Cleaved into: Processed beta-1,4-galactosyltransferase 1] [Includes: Lactose synthase A protein (EC 2.4.1.22); N-acetyllactosamine synthase (EC 2.4.1.90) (Nal synthase); Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase (EC 2.4.1.38); Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase (EC 2.4.1.-)]
- Gene Names:
- B4GALT1 GGTB2
- Gene Names Primary:
- B4GALT1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 398
- Sequence:
- MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Isoform Long: Golgi apparatus, Golgi stack membrane
Function
- Function:
- The Golgi complex form catalyzes the production of lactose in the lactating mammary gland and could also be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.; The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix.
- Pathway:
- Protein modification; protein glycosylation.
- Catalytic Activity:
- UDP-alpha-D-galactose + D-glucose = UDP + lactose.; UDP-alpha-D-galactose + N-acetyl-beta-D-glucosaminylglycopeptide = UDP + beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminylglycopeptide.; UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine.
- Cofactor:
- COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Cross Reference Drug Bank:
- DB00141
- Gene Ontology Go:
- basolateral plasma membrane
brush border membrane
desmosome
external side of plasma membrane
extracellular exosome
extracellular space
filopodium
glycocalyx
Golgi apparatus
Golgi cisterna membrane
Golgi membrane
Golgi trans cisterna
integral component of membrane
membrane
plasma membrane
alpha-tubulin binding
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
beta-tubulin binding
galactosyltransferase activity
lactose synthase activity
manganese ion binding
N-acetyllactosamine synthase activity
protein homodimerization activity
UDP-galactosyltransferase activity
acute inflammatory response
angiogenesis involved in wound healing
binding of sperm to zona pellucida
branching morphogenesis of an epithelial tube
carbohydrate metabolic process
cell adhesion
cellular protein metabolic process
development of secondary sexual characteristics
epithelial cell development
extracellular matrix organization
galactose metabolic process
glycosaminoglycan metabolic process
keratan sulfate biosynthetic process
keratan sulfate metabolic process
lactose biosynthetic process
leukocyte migration
mammary gland development
multicellular organism reproduction
negative regulation of cell proliferation
Notch signaling pathway
oligosaccharide biosynthetic process
penetration of zona pellucida
positive regulation of apoptotic process involved in mammary gland involution
positive regulation of epithelial cell proliferation involved in wound healing
post-translational protein modification
protein N-linked glycosylation
protein N-linked glycosylation via asparagine
regulation of acrosome reaction
regulation of cellular component movement
single fertilization
small molecule metabolic process - Gene Ontology Biological Process:
- acute inflammatory response
angiogenesis involved in wound healing
binding of sperm to zona pellucida
branching morphogenesis of an epithelial tube
carbohydrate metabolic process
cell adhesion
cellular protein metabolic process
development of secondary sexual characteristics
epithelial cell development
extracellular matrix organization
galactose metabolic process
glycosaminoglycan metabolic process
keratan sulfate biosynthetic process
keratan sulfate metabolic process
lactose biosynthetic process
leukocyte migration
mammary gland development
multicellular organism reproduction
negative regulation of cell proliferation
Notch signaling pathway
oligosaccharide biosynthetic process
penetration of zona pellucida
positive regulation of apoptotic process involved in mammary gland involution
positive regulation of epithelial cell proliferation involved in wound healing
post-translational protein modification
protein N-linked glycosylation
protein N-linked glycosylation via asparagine
regulation of acrosome reaction
regulation of cellular component movement
single fertilization
small molecule metabolic process - Gene Ontology Molecular Function:
- alpha-tubulin binding
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
beta-tubulin binding
galactosyltransferase activity
lactose synthase activity
manganese ion binding
N-acetyllactosamine synthase activity
protein homodimerization activity
UDP-galactosyltransferase activity - Gene Ontology Cellular Component:
- basolateral plasma membrane
brush border membrane
desmosome
external side of plasma membrane
extracellular exosome
extracellular space
filopodium
glycocalyx
Golgi apparatus
Golgi cisterna membrane
Golgi membrane
Golgi trans cisterna
integral component of membrane
membrane
plasma membrane - Keywords:
- 3D-structure
Alternative initiation
Cell membrane
Cell projection
Complete proteome
Congenital disorder of glycosylation
Direct protein sequencing
Disulfide bond
Glycoprotein
Glycosyltransferase
Golgi apparatus
Manganese
Membrane
Metal-binding
Polymorphism
Reference proteome
Secreted
Signal-anchor
Transferase
Transmembrane
Transmembrane helix